Arrowhead Mills - All Natural Puffed Millet cereal - case Of 12 - 6 Oz(D0102H5WDS8)
$53.17
Viewed 20 times
Taxes will be calculated at Checkout.
US Delivery Time: 3-5 Business Days.
US Delivery Time: 3-5 Business Days.
Categories
Cart
Account
Search
Recent View
Go to Top
Shopping Cart
×
Your shopping cart is empty!
Search
×
Recent View Products
×
Product Description
Arrowhead Mills - All Natural Puffed Millet cereal - case Of 12 - 6 Oz(D0102H5WDS8)
Details:Arrowhead mills natural puffed millet cereal give you a delicious, nutritious start to your day Millet is the smallest of all grains and has been used longer than rice or wheat It has a mild flavor with a whole lot of whole grain goodness You’ll get 2 g Of protein and 2 g Of fiber per serving And it has only 60 calories per serving This all natural product has no cholesterol and has no sugar or salt added Includes one 6 oz Bag of arrowhead mills natural puffed millet cereal As arrowhead mills has grown, our brand and our product line have grown with us Over the years, weve added hot and cold cereals, as well as delicious pancake, waffle, cake and brownie mixes nut butters seasonal products and gluten-free products&mdashall of which taste great, are all-natural and are entirely free of chemical pesticides and herbicidescountry of origin : united statesis gmo free : yesis kosher : yesis wheat free : yessize : 6 ozpack of : 12selling unit : casekeywords : branbreakfastflakesgrainshealthymilkwheatwholeSpecification of Arrowhead Mills - All Natural Puffed Millet cereal - case Of 12 - 6 Oz(D0102H5WDS8)
Product Details | |
---|---|
Weight | 6 |
Warning - California Proposition 65
This product may contain chemicals known to the State of California to cause cancer, birth defects, or other reproductive harm.